SCOPe 2.07: Domain d6blba2: 6blb A:260-338

Lineage for d6blba2 (6blb A:260-338)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (2 PDB entries)

8. Domain d6blba2: 6blb A:260-338 [341832]
   Other proteins in same PDB: d6blba1
   automated match to d1in4a1
   protein/DNA complex; complexed with adp, pge

Details for d6blba2

PDB Entry: 6blb, 1.88 Å

PDB Description: 1.88 angstrom resolution crystal structure holliday junction atp- dependent dna helicase (ruvb) from pseudomonas aeruginosa in complex with adp

PDB Compounds: (A:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d6blba2:

Sequence; same for both SEQRES and ATOM records:

>d6blba2 a.4.5.0 (A:260-338) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rgfdhldrrllltmidkfdggpvgidnlaaalseerhtiedvlepyliqqgyimrtprgr
vvtrhaylhfglnipkrlg

Timeline for d6blba2:

• d6blba2 first appeared in SCOPe 2.06
  
• d6blba2 appears in the current release, SCOPe 2.08