SCOPe 2.08: Domain d5ongb_: 5ong B:

Lineage for d5ongb_ (5ong B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)

8. Domain d5ongb_: 5ong B: [341830]
   Other proteins in same PDB: d5ongc_, d5ongd_, d5ongg_, d5ongh_
   automated match to d1tzyd_
   complexed with cl, mn

Details for d5ongb_

PDB Entry: 5ong, 2.8 Å

PDB Description: x-ray crystal structure of a nucleosome core particle with its dna site-specifically crosslinked to the histone octamer

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5ongb_:

Sequence; same for both SEQRES and ATOM records:

>d5ongb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg

Timeline for d5ongb_:

• d5ongb_ first appeared in SCOPe 2.06
  
• d5ongb_ appears in SCOPe 2.07