Lineage for d5gvta_ (5gvt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066346Domain d5gvta_: 5gvt A: [341824]
    automated match to d2anwa_
    complexed with bma, man

Details for d5gvta_

PDB Entry: 5gvt (more details), 2.61 Å

PDB Description: crystal structures of the serine protease domain of murine plasma kallikrein
PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d5gvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gvta_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq

SCOPe Domain Coordinates for d5gvta_:

Click to download the PDB-style file with coordinates for d5gvta_.
(The format of our PDB-style files is described here.)

Timeline for d5gvta_: