Lineage for d6ao9a_ (6ao9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197744Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2197745Protein automated matches [191274] (12 species)
    not a true protein
  7. 2197746Species Blastocladiella emersonii [TaxId:4808] [341767] (3 PDB entries)
  8. 2197747Domain d6ao9a_: 6ao9 A: [341822]
    automated match to d4p2xb_

Details for d6ao9a_

PDB Entry: 6ao9 (more details), 1.13 Å

PDB Description: crystal structure of monomeric guanylyl cyclase domain of rhogc fusion protein from the aquatic fungus blastocladiella emersonii
PDB Compounds: (A:) Bacterio-rhodopsin/guanylyl cyclase 1 fusion protein

SCOPe Domain Sequences for d6ao9a_:

Sequence, based on SEQRES records: (download)

>d6ao9a_ d.58.29.0 (A:) automated matches {Blastocladiella emersonii [TaxId: 4808]}
teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigda
ylgvtgapdvvpdhaeracnfavdiiemiksfktitgesiniriglnsgpvtagvlgdln
phwclvgdtvntasrmestskaghihisestyhfikskfvtqpldvmevkgkgkmqtywv
lgrk

Sequence, based on observed residues (ATOM records): (download)

>d6ao9a_ d.58.29.0 (A:) automated matches {Blastocladiella emersonii [TaxId: 4808]}
teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigda
ylgvtgapdvvpdhaeracnfavdiiemiksfktitgesiniriglnsgpvtagvlphwc
lvgdtvntasrmestskaghihisestyhfikskfvtqpldmqtywvlgrk

SCOPe Domain Coordinates for d6ao9a_:

Click to download the PDB-style file with coordinates for d6ao9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ao9a_: