Lineage for d1dusa_ (1dus A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892902Family c.66.1.4: Hypothetical protein MJ0882 [53345] (1 protein)
    automatically mapped to Pfam PF05175
  6. 2892903Protein Hypothetical protein MJ0882 [53346] (1 species)
  7. 2892904Species Methanococcus jannaschii [TaxId:2190] [53347] (1 PDB entry)
  8. 2892905Domain d1dusa_: 1dus A: [34182]
    structural genomics

Details for d1dusa_

PDB Entry: 1dus (more details), 1.8 Å

PDB Description: MJ0882-A hypothetical protein from M. jannaschii
PDB Compounds: (A:) mj0882

SCOPe Domain Sequences for d1dusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Methanococcus jannaschii [TaxId: 2190]}
fsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvdkdddildlg
cgygvigialadevksttmadinrraiklakeniklnnldnydirvvhsdlyenvkdrky
nkiitnppiragkevlhriieegkellkdngeiwvviqtkqgakslakymkdvfgnvetv
tikggyrvlkskkl

SCOPe Domain Coordinates for d1dusa_:

Click to download the PDB-style file with coordinates for d1dusa_.
(The format of our PDB-style files is described here.)

Timeline for d1dusa_: