Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.4: Hypothetical protein MJ0882 [53345] (1 protein) automatically mapped to Pfam PF05175 |
Protein Hypothetical protein MJ0882 [53346] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [53347] (1 PDB entry) |
Domain d1dusa_: 1dus A: [34182] structural genomics |
PDB Entry: 1dus (more details), 1.8 Å
SCOPe Domain Sequences for d1dusa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Methanococcus jannaschii [TaxId: 2190]} fsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvdkdddildlg cgygvigialadevksttmadinrraiklakeniklnnldnydirvvhsdlyenvkdrky nkiitnppiragkevlhriieegkellkdngeiwvviqtkqgakslakymkdvfgnvetv tikggyrvlkskkl
Timeline for d1dusa_: