SCOPe 2.07: Domain d5h74d1: 5h74 D:1-243

Lineage for d5h74d1 (5h74 D:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)

8. Domain d5h74d1: 5h74 D:1-243 [341811]
   Other proteins in same PDB: d5h74a2, d5h74b2, d5h74c2, d5h74d2, d5h74e_, d5h74f1, d5h74f2, d5h74f3
   automated match to d4drxb1
   complexed with 7lg, acp, ca, gdp, gtp, mes, mg

Details for d5h74d1

PDB Entry: 5h74, 2.6 Å

PDB Description: crystal structure of t2r-ttl-14b complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5h74d1:

Sequence; same for both SEQRES and ATOM records:

>d5h74d1 c.32.1.1 (D:1-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5h74d1:

• d5h74d1 first appeared in SCOPe 2.06
  
• d5h74d1 appears in the current release, SCOPe 2.08