Lineage for d5h6za_ (5h6z A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083796Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2083874Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2083875Protein automated matches [226914] (2 species)
    not a true protein
  7. 2083926Species Schizosaccharomyces pombe [TaxId:284812] [341801] (2 PDB entries)
  8. 2083927Domain d5h6za_: 5h6z A: [341804]
    Other proteins in same PDB: d5h6zb2
    automated match to d3kmta_
    complexed with nh4, peg, so4

Details for d5h6za_

PDB Entry: 5h6z (more details), 2 Å

PDB Description: crystal structure of set7, a novel histone methyltransferase in schizossacharomyces pombe
PDB Compounds: (A:) SET domain-containing protein 7

SCOPe Domain Sequences for d5h6za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h6za_ b.85.7.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqytvlneyty
vwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcisygdhlwf
ede

SCOPe Domain Coordinates for d5h6za_:

Click to download the PDB-style file with coordinates for d5h6za_.
(The format of our PDB-style files is described here.)

Timeline for d5h6za_: