Lineage for d5h7fa_ (5h7f A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563291Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2563292Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2563354Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2563355Protein automated matches [190796] (6 species)
    not a true protein
  7. 2563358Species Deinococcus radiodurans [TaxId:1299] [339496] (2 PDB entries)
  8. 2563359Domain d5h7fa_: 5h7f A: [341803]
    automated match to d1iuha_
    complexed with so4

Details for d5h7fa_

PDB Entry: 5h7f (more details), 1.6 Å

PDB Description: crystal structure of mn-derivative drcpdase
PDB Compounds: (A:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5h7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7fa_ d.61.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
hqpstyrlfyalrvpaditaplaeaqaklrgnwravrpdqmhvtlsylpavppervedlk
rlgtrltqdlpplhvnlrgtgyfpnegsprvwfvkteaegltelaenlragirelgigtd
dlafkahitlarkkgpaprlpplifdqswtapgltlyrsilrktgpiyevqstfrfrgsa
sq

SCOPe Domain Coordinates for d5h7fa_:

Click to download the PDB-style file with coordinates for d5h7fa_.
(The format of our PDB-style files is described here.)

Timeline for d5h7fa_: