SCOPe 2.08: Domain d6bk7b2: 6bk7 B:281-404

Lineage for d6bk7b2 (6bk7 B:281-404)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (29 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [341796] (1 PDB entry)

8. Domain d6bk7b2: 6bk7 B:281-404 [341799]
   Other proteins in same PDB: d6bk7a1, d6bk7b1
   automated match to d2bv3a1
   complexed with na

Details for d6bk7b2

PDB Entry: 6bk7, 1.83 Å

PDB Description: 1.83 angstrom resolution crystal structure of n-terminal fragment (residues 1-404) of elongation factor g from enterococcus faecalis

PDB Compounds: (B:) Elongation factor G

SCOPe Domain Sequences for d6bk7b2:

Sequence; same for both SEQRES and ATOM records:

>d6bk7b2 b.43.3.0 (B:281-404) automated matches {Enterococcus faecalis [TaxId: 226185]}
pldidaikgidtktdeettrpaddeapfaslafkvmtdpfvgrltffrvysgvlesgsyv
lnaskgkkerigrilqmhantrqeidkvysgdiaaavglkdtttgdtlcaldapvilesi
efpd

Timeline for d6bk7b2:

• d6bk7b2 first appeared in SCOPe 2.06
  
• d6bk7b2 appears in SCOPe 2.07