Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [341792] (1 PDB entry) |
Domain d6bk7b1: 6bk7 B:1-280 [341794] Other proteins in same PDB: d6bk7a2, d6bk7b2 automated match to d1efga2 complexed with na |
PDB Entry: 6bk7 (more details), 1.83 Å
SCOPe Domain Sequences for d6bk7b1:
Sequence, based on SEQRES records: (download)
>d6bk7b1 c.37.1.0 (B:1-280) automated matches {Enterococcus faecalis [TaxId: 226185]} marefslektrnigimahvdagktttterilyytgkihkigethegasqmdwmeqeqerg ititsaattaqwkgyrvniidtpghvdftievqrslrvldgavtvldsqsgvepqtetvw rqateykvprivfcnkmdkigadffysveslhdrlqanahpiqipigaeedftgiidlik mkaeiytndlgtdiqetdipedylekaqewreklveavaetdedlmmkylegeeiteeel vagirqatinveffpvlagsafknkgvqlmldavldylps
>d6bk7b1 c.37.1.0 (B:1-280) automated matches {Enterococcus faecalis [TaxId: 226185]} marefslektrnigimahvdagktttterilyytgkititsaattaqwkgyrvniidtpg hvdftievqrslrvldgavtvldsqsgvepqtetvwrqateykvprivfcnkmdkigadf fysveslhdrlqanahpiqipigaeedftgiidlikmkaeiytndlgtdiqetdipedyl ekaqewreklveavaetdedlmmkylegeeiteeelvagirqatinveffpvlagsafkn kgvqlmldavldylps
Timeline for d6bk7b1: