SCOPe 2.06: Domain d6b9jl2: 6b9j L:109-215

Lineage for d6b9jl2 (6b9j L:109-215)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d6b9jl2: 6b9j L:109-215 [341789]
Other proteins in same PDB: d6b9jb1, d6b9jl1, d6b9jx1, d6b9jx2, d6b9jy1, d6b9jy2
automated match to d1dn0a2
complexed with gol, na

Details for d6b9jl2

PDB Entry: 6b9j (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138

PDB Compounds: (L:) Fab vv138 Light chain

SCOPe Domain Sequences for d6b9jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9jl2 b.1.1.2 (L:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6b9jl2:

Click to download the PDB-style file with coordinates for d6b9jl2.
(The format of our PDB-style files is described here.)

Timeline for d6b9jl2: