Lineage for d6aoba1 (6aob A:442-626)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954862Species Blastocladiella emersonii [TaxId:4808] [341767] (3 PDB entries)
  8. 2954865Domain d6aoba1: 6aob A:442-626 [341770]
    Other proteins in same PDB: d6aoba2
    automated match to d4p2xb_
    complexed with mn, tla

Details for d6aoba1

PDB Entry: 6aob (more details), 1.7 Å

PDB Description: crystal structure of non-canonical dimeric guanylyl cyclase domain of rhogc fusion protein from the aquatic fungus blastocladiella emersonii
PDB Compounds: (A:) Bacterio-rhodopsin/guanylyl cyclase 1 fusion protein

SCOPe Domain Sequences for d6aoba1:

Sequence, based on SEQRES records: (download)

>d6aoba1 d.58.29.0 (A:442-626) automated matches {Blastocladiella emersonii [TaxId: 4808]}
mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigd
aylgvtgapdvvpdhaeracnfavdiiemiksfktitgesiniriglnsgpvtagvlgdl
nphwclvgdtvntasrmestskaghihisestyhfikskfvtqpldvmevkgkgkmqtyw
vlgrk

Sequence, based on observed residues (ATOM records): (download)

>d6aoba1 d.58.29.0 (A:442-626) automated matches {Blastocladiella emersonii [TaxId: 4808]}
mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigd
aylgvtgapdvvpdhaeracnfavdiiemiksfktitgesiniriglnsgpvtagvlgdl
nphwclvgdtvntasrmestskaghihisestyhfikskfvtqpldvmkmqtywvlgrk

SCOPe Domain Coordinates for d6aoba1:

Click to download the PDB-style file with coordinates for d6aoba1.
(The format of our PDB-style files is described here.)

Timeline for d6aoba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6aoba2
View in 3D
Domains from other chains:
(mouse over for more information)
d6aobb_