SCOPe 2.06: Domain d5wlga2: 5wlg A:182-278

Lineage for d5wlga2 (5wlg A:182-278)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5wlga2: 5wlg A:182-278 [341752]
   Other proteins in same PDB: d5wlga1, d5wlgb_, d5wlgd2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi2
   automated match to d1kjva1
   complexed with cl, na

Details for d5wlga2

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5wlga2:

Sequence; same for both SEQRES and ATOM records:

>d5wlga2 b.1.1.0 (A:182-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrweppp

Timeline for d5wlga2:

• d5wlga2 is new in SCOPe 2.06-stable
  
• d5wlga2 appears in SCOPe 2.07
  
• d5wlga2 appears in the current release, SCOPe 2.08