SCOPe 2.06: Domain d5wlga1: 5wlg A:1-181

Lineage for d5wlga1 (5wlg A:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mus musculus [TaxId:10090] [341655] (1 PDB entry)

8. Domain d5wlga1: 5wlg A:1-181 [341751]
   Other proteins in same PDB: d5wlga2, d5wlgb_, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf2, d5wlgg_, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2
   automated match to d1kjva2
   complexed with cl, na

Details for d5wlga1

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5wlga1:

Sequence; same for both SEQRES and ATOM records:

>d5wlga1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mus musculus [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d5wlga1:

• d5wlga1 is new in SCOPe 2.06-stable
  
• d5wlga1 appears in SCOPe 2.07
  
• d5wlga1 appears in the current release, SCOPe 2.08