SCOPe 2.08: Domain d5yl4c2: 5yl4 C:246-440

Lineage for d5yl4c2 (5yl4 C:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5yl4c2: 5yl4 C:246-440 [341750]
   Other proteins in same PDB: d5yl4a1, d5yl4b1, d5yl4c1, d5yl4d1, d5yl4e_, d5yl4f1, d5yl4f2, d5yl4f3
   automated match to d4i50a2
   complexed with 8wr, acp, ca, gdp, gtp, mes, mg

Details for d5yl4c2

PDB Entry: 5yl4, 2.64 Å

PDB Description: crystal structure of t2r-ttl-8wr complex

PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5yl4c2:

Sequence; same for both SEQRES and ATOM records:

>d5yl4c2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5yl4c2:

• d5yl4c2 first appeared in SCOPe 2.06
  
• d5yl4c2 appears in SCOPe 2.07