Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein automated matches [190299] (8 species) not a true protein |
Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries) |
Domain d5v92a_: 5v92 A: [341742] automated match to d2vb1a_ complexed with po4, trs |
PDB Entry: 5v92 (more details), 1.11 Å
SCOPe Domain Sequences for d5v92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v92a_ d.2.1.2 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]} kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv skwirgcrl
Timeline for d5v92a_: