Lineage for d5v92a_ (5v92 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2925556Protein automated matches [190299] (8 species)
    not a true protein
  7. 2925611Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)
  8. 2925612Domain d5v92a_: 5v92 A: [341742]
    automated match to d2vb1a_
    complexed with po4, trs

Details for d5v92a_

PDB Entry: 5v92 (more details), 1.11 Å

PDB Description: pekin duck egg lysozyme isoform iii (del-iii), orthorhombic form
PDB Compounds: (A:) lysozyme isoform III

SCOPe Domain Sequences for d5v92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v92a_ d.2.1.2 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
skwirgcrl

SCOPe Domain Coordinates for d5v92a_:

Click to download the PDB-style file with coordinates for d5v92a_.
(The format of our PDB-style files is described here.)

Timeline for d5v92a_: