Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries) |
Domain d5yl4b2: 5yl4 B:244-428 [341740] Other proteins in same PDB: d5yl4a1, d5yl4b1, d5yl4c1, d5yl4d1, d5yl4e_, d5yl4f1, d5yl4f2, d5yl4f3 automated match to d3rycd2 complexed with 8wr, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5yl4 (more details), 2.64 Å
SCOPe Domain Sequences for d5yl4b2:
Sequence, based on SEQRES records: (download)
>d5yl4b2 d.79.2.1 (B:244-428) automated matches {Sus barbatus [TaxId: 41807]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d5yl4b2 d.79.2.1 (B:244-428) automated matches {Sus barbatus [TaxId: 41807]} gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd a
Timeline for d5yl4b2: