Lineage for d1fmta2 (1fmt A:1-206)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129160Family c.65.1.1: Formyltransferase [53329] (5 protein domains)
  6. 2129223Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species)
  7. 2129227Species Escherichia coli [TaxId:562] [53333] (2 PDB entries)
  8. 2129228Domain d1fmta2: 1fmt A:1-206 [34174]
    Other proteins in same PDB: d1fmta1, d1fmtb1

Details for d1fmta2

PDB Entry: 1fmt (more details), 2 Å

PDB Description: methionyl-trnafmet formyltransferase from escherichia coli
PDB Compounds: (A:) methionyl-tRNA fmet formyltransferase

SCOPe Domain Sequences for d1fmta2:

Sequence, based on SEQRES records: (download)

>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]}
seslriifagtpdfaarhldallssghnvvgvftqpdrpagrgkklmpspvkvlaeekgl
pvfqpvslrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrga
apiqrslwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqgli
ttlkqladgtakpevqdetlvtyaek

Sequence, based on observed residues (ATOM records): (download)

>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]}
seslriifagtpdfaarhldallssghnvvgvftqpdrplmpspvkvlaeekglpvfqpv
slrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrgaapiqrs
lwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqglittlkql
adgtakpevqdetlvtyaek

SCOPe Domain Coordinates for d1fmta2:

Click to download the PDB-style file with coordinates for d1fmta2.
(The format of our PDB-style files is described here.)

Timeline for d1fmta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fmta1