Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Escherichia coli [TaxId:562] [323327] (5 PDB entries) |
Domain d5wipb_: 5wip B: [341737] automated match to d4nhfa_ complexed with xxo |
PDB Entry: 5wip (more details), 2.62 Å
SCOPe Domain Sequences for d5wipb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wipb_ d.17.4.0 (B:) automated matches {Escherichia coli [TaxId: 562]} trdqtsygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngl dkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeyksla mnaeqryvnplgfrvtsyrvnpe
Timeline for d5wipb_: