Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5wlgi2: 5wlg I:111-185 [341728] Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlge1, d5wlge2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi1, d5wlgj1, d5wlgj2 automated match to d2cdga2 complexed with cl, na |
PDB Entry: 5wlg (more details), 2.1 Å
SCOPe Domain Sequences for d5wlgi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wlgi2 b.1.1.2 (I:111-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacana
Timeline for d5wlgi2: