Lineage for d1cdda_ (1cdd A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26052Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 26053Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 26054Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 26055Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 26056Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 26068Domain d1cdda_: 1cdd A: [34172]

Details for d1cdda_

PDB Entry: 1cdd (more details), 2.8 Å

PDB Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase

SCOP Domain Sequences for d1cdda_:

Sequence, based on SEQRES records: (download)

>d1cdda_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgyaade

Sequence, based on observed residues (ATOM records): (download)

>d1cdda_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpgtsvhfvtdel
dggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgqrl
ppqgyaade

SCOP Domain Coordinates for d1cdda_:

Click to download the PDB-style file with coordinates for d1cdda_.
(The format of our PDB-style files is described here.)

Timeline for d1cdda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cddb_