Lineage for d5wpia_ (5wpi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974447Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2974448Protein automated matches [190175] (10 species)
    not a true protein
  7. 2974463Species Erwinia amylovora [TaxId:552] [341718] (1 PDB entry)
  8. 2974464Domain d5wpia_: 5wpi A: [341719]
    automated match to d1jdwa_
    complexed with edo

Details for d5wpia_

PDB Entry: 5wpi (more details), 2.3 Å

PDB Description: the virulence-associated protein hsva from the fire blight pathogen erwinia amylovora is a polyamine amidinotransferase
PDB Compounds: (A:) HsvA

SCOPe Domain Sequences for d5wpia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wpia_ d.126.1.0 (A:) automated matches {Erwinia amylovora [TaxId: 552]}
yqkeepsyfshspspvevytewdpleevivgimddirvpdwdkslkaiipeenhdffqty
sgkrfpeellikarqevetlaqilqaegirvkrpnesnhhqpimtphfttggtfysampr
dclfaigkkiievpmswrsryfetfafrdilndyftrgaewiaapkpmlsddvwekdfdf
eqefpfrsiiteveplfdaadfmkmgrdiigqrshatnkkgiewlrrtlgpdyhihiyef
depapmhidttilplapgrvlinkgwvpqipdifkdweilnppasnlpddhplymssnwi
htnvlmldektviveedeealisafrqwgfktilcpfkhfqtfggsfhcatldvkrsgsl
ksyi

SCOPe Domain Coordinates for d5wpia_:

Click to download the PDB-style file with coordinates for d5wpia_.
(The format of our PDB-style files is described here.)

Timeline for d5wpia_: