Lineage for d1grcb_ (1grc B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26052Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 26053Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 26054Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 26055Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 26056Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 26067Domain d1grcb_: 1grc B: [34171]

Details for d1grcb_

PDB Entry: 1grc (more details), 3 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy

SCOP Domain Sequences for d1grcb_:

Sequence, based on SEQRES records: (download)

>d1grcb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Sequence, based on observed residues (ATOM records): (download)

>d1grcb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkhgtsvh
fvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaaw
ldgqrlppqgya

SCOP Domain Coordinates for d1grcb_:

Click to download the PDB-style file with coordinates for d1grcb_.
(The format of our PDB-style files is described here.)

Timeline for d1grcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1grca_