SCOPe 2.08: Domain d5vx1b1: 5vx1 B:23-182

Lineage for d5vx1b1 (5vx1 B:23-182)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)

8. Domain d5vx1b1: 5vx1 B:23-182 [341703]
   Other proteins in same PDB: d5vx1a2, d5vx1b2
   automated match to d2imta_

Details for d5vx1b1

PDB Entry: 5vx1, 1.22 Å

PDB Description: bak l100a

PDB Compounds: (B:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d5vx1b1:

Sequence; same for both SEQRES and ATOM records:

>d5vx1b1 f.1.4.0 (B:23-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaiig
ddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgyrlalhv
yqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaaln

Timeline for d5vx1b1:

• d5vx1b1 first appeared in SCOPe 2.06
  
• d5vx1b1 appears in SCOPe 2.07