Lineage for d1cde__ (1cde -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72939Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 72940Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 72941Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 72942Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 72943Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 72952Domain d1cde__: 1cde - [34169]

Details for d1cde__

PDB Entry: 1cde (more details), 2.5 Å

PDB Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase

SCOP Domain Sequences for d1cde__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cde__ c.65.1.1 (-) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOP Domain Coordinates for d1cde__:

Click to download the PDB-style file with coordinates for d1cde__.
(The format of our PDB-style files is described here.)

Timeline for d1cde__: