Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5wlge1: 5wlg E:1-114 [341687] Other proteins in same PDB: d5wlga1, d5wlgb_, d5wlgd2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi2 automated match to d2axha1 complexed with cl, na |
PDB Entry: 5wlg (more details), 2.1 Å
SCOPe Domain Sequences for d5wlge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wlge1 b.1.1.0 (E:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi pdgykasrpsqenfslilelaslsqtavyfcassdwgdtgqlyfgegskltvle
Timeline for d5wlge1: