![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) |
![]() | Superfamily c.65.1: Formyltransferase [53328] (1 family) ![]() |
![]() | Family c.65.1.1: Formyltransferase [53329] (2 proteins) |
![]() | Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species) |
![]() | Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries) |
![]() | Domain d1c2tb_: 1c2t B: [34168] |
PDB Entry: 1c2t (more details), 2.1 Å
SCOP Domain Sequences for d1c2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2tb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167} mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv iswfadgrlkmhenaawldgqrlppqgya
Timeline for d1c2tb_: