Lineage for d5wlgd2 (5wlg D:110-186)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362149Domain d5wlgd2: 5wlg D:110-186 [341668]
    Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlge1, d5wlge2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi1, d5wlgj1, d5wlgj2
    automated match to d2cdga2
    complexed with cl, na

Details for d5wlgd2

PDB Entry: 5wlg (more details), 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)
PDB Compounds: (D:) T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain chimera

SCOPe Domain Sequences for d5wlgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wlgd2 b.1.1.2 (D:110-186) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

SCOPe Domain Coordinates for d5wlgd2:

Click to download the PDB-style file with coordinates for d5wlgd2.
(The format of our PDB-style files is described here.)

Timeline for d5wlgd2: