SCOPe 2.06: Domain d5wlgd2: 5wlg D:110-186

Lineage for d5wlgd2 (5wlg D:110-186)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5wlgd2: 5wlg D:110-186 [341668]
   Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlge1, d5wlge2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi1, d5wlgj1, d5wlgj2
   automated match to d2cdga2
   complexed with cl, na

Details for d5wlgd2

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (D:) T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain chimera

SCOPe Domain Sequences for d5wlgd2:

Sequence; same for both SEQRES and ATOM records:

>d5wlgd2 b.1.1.2 (D:110-186) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

Timeline for d5wlgd2:

• d5wlgd2 is new in SCOPe 2.06-stable
  
• d5wlgd2 appears in SCOPe 2.07
  
• d5wlgd2 appears in the current release, SCOPe 2.08