Lineage for d1c3eb_ (1c3e B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72939Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 72940Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 72941Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 72942Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 72943Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 72949Domain d1c3eb_: 1c3e B: [34166]

Details for d1c3eb_

PDB Entry: 1c3e (more details), 2.1 Å

PDB Description: new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.

SCOP Domain Sequences for d1c3eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3eb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOP Domain Coordinates for d1c3eb_:

Click to download the PDB-style file with coordinates for d1c3eb_.
(The format of our PDB-style files is described here.)

Timeline for d1c3eb_: