SCOPe 2.08: Domain d1c3eb_: 1c3e B:

Lineage for d1c3eb_ (1c3e B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)

8. Domain d1c3eb_: 1c3e B: [34166]
   complexed with gar, nhr

Details for d1c3eb_

PDB Entry: 1c3e, 2.1 Å

PDB Description: new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.

PDB Compounds: (B:) glycinamide ribonucleotide transformylase

SCOPe Domain Sequences for d1c3eb_:

Sequence; same for both SEQRES and ATOM records:

>d1c3eb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Timeline for d1c3eb_:

• d1c3eb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3eb_ appears in SCOPe 2.07