SCOPe 2.06: Domain d5wlgf2: 5wlg F:182-277

Lineage for d5wlgf2 (5wlg F:182-277)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d5wlgf2: 5wlg F:182-277 [341657]
   Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf1, d5wlgg_, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2
   automated match to d1kjva1
   complexed with cl, na

Details for d5wlgf2

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (F:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5wlgf2:

Sequence; same for both SEQRES and ATOM records:

>d5wlgf2 b.1.1.2 (F:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

Timeline for d5wlgf2:

• d5wlgf2 is new in SCOPe 2.06-stable
  
• d5wlgf2 appears in SCOPe 2.07
  
• d5wlgf2 appears in the current release, SCOPe 2.08