SCOP 1.57: Domain d1c3ea_: 1c3e A:

Lineage for d1c3ea_ (1c3e A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)

4. Superfamily c.65.1: Formyltransferase [53328] (1 family)

5. Family c.65.1.1: Formyltransferase [53329] (2 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)

7. Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)

8. Domain d1c3ea_: 1c3e A: [34165]

Details for d1c3ea_

PDB Entry: 1c3e, 2.1 Å

PDB Description: new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.

SCOP Domain Sequences for d1c3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1c3ea_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Timeline for d1c3ea_:

• d1c3ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3ea_ appears in SCOP 1.59
  
• d1c3ea_ appears in the current release, SCOPe 2.08