Lineage for d3gar__ (3gar -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72939Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 72940Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 72941Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 72942Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 72943Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 72947Domain d3gar__: 3gar - [34164]

Details for d3gar__

PDB Entry: 3gar (more details), 1.9 Å

PDB Description: a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase

SCOP Domain Sequences for d3gar__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gar__ c.65.1.1 (-) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOP Domain Coordinates for d3gar__:

Click to download the PDB-style file with coordinates for d3gar__.
(The format of our PDB-style files is described here.)

Timeline for d3gar__: