Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Uncultured archaeon [TaxId:743092] [341638] (4 PDB entries) |
Domain d5y1ea_: 5y1e A: [341639] automated match to d3wmxa_ complexed with nad, ser |
PDB Entry: 5y1e (more details), 1.9 Å
SCOPe Domain Sequences for d5y1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y1ea_ c.2.1.0 (A:) automated matches {Uncultured archaeon [TaxId: 743092]} milvtgalgqigtelvlalqekygndkiiasdlkepenyhckfekcdirdietyerinne nkieivyhlaailsaageknpelchdvnynglenvlktakkynqklfcpssiavfgpdvp kemtpqnvelnpktvygitkvkgeelcdtyfkehgidvrgirypgliswkhkpsggttdy avemyfdavesgkyecfvnrntrlpmmfmddairatlelmdapldslnyhsnynlssmsf saeelekeisahvdfnclykpdyrqdiadtwpisindddarkdwgwepkfdiskmteemi tnlrrlne
Timeline for d5y1ea_: