Lineage for d5wicc_ (5wic C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937206Species Escherichia coli [TaxId:562] [323327] (5 PDB entries)
  8. 2937213Domain d5wicc_: 5wic C: [341636]
    automated match to d4nhfa_
    complexed with foa

Details for d5wicc_

PDB Entry: 5wic (more details), 2.55 Å

PDB Description: trae protein in complex with 2-furoic acid (foa)
PDB Compounds: (C:) Conjugal transfer protein

SCOPe Domain Sequences for d5wicc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wicc_ d.17.4.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
ygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngldkvlgd
settrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeykslamnaeqr
yvnplgfrvtsyrvnpe

SCOPe Domain Coordinates for d5wicc_:

Click to download the PDB-style file with coordinates for d5wicc_.
(The format of our PDB-style files is described here.)

Timeline for d5wicc_: