Lineage for d5oo6h_ (5oo6 H:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2519437Protein automated matches [190332] (5 species)
    not a true protein
  7. 2519440Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2519507Domain d5oo6h_: 5oo6 H: [341632]
    automated match to d1h2ux_
    complexed with mgt

Details for d5oo6h_

PDB Entry: 5oo6 (more details), 2.8 Å

PDB Description: complex of human nuclear cap-binding complex with ars2 c-terminal peptide
PDB Compounds: (H:) Nuclear cap-binding protein subunit 2

SCOPe Domain Sequences for d5oo6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oo6h_ d.58.7.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
qygrgrsggqvrdeyrqdydagrggygk

SCOPe Domain Coordinates for d5oo6h_:

Click to download the PDB-style file with coordinates for d5oo6h_.
(The format of our PDB-style files is described here.)

Timeline for d5oo6h_: