Lineage for d5tvhe1 (5tvh E:1-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (60 PDB entries)
  8. 2408851Domain d5tvhe1: 5tvh E:1-208 [341630]
    Other proteins in same PDB: d5tvha2, d5tvhb2, d5tvhc2, d5tvhd2, d5tvhe2
    automated match to d2w8gc_
    complexed with 7ko, dms, nag

Details for d5tvhe1

PDB Entry: 5tvh (more details), 2.4 Å

PDB Description: crystal structure of achbp from aplysia californica complex with 2- aminopyrimidine at ph 8.0 spacegroup p21
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5tvhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tvhe1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d5tvhe1:

Click to download the PDB-style file with coordinates for d5tvhe1.
(The format of our PDB-style files is described here.)

Timeline for d5tvhe1: