Lineage for d1garb_ (1gar B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129160Family c.65.1.1: Formyltransferase [53329] (5 protein domains)
  6. 2129167Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2129168Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 2129175Domain d1garb_: 1gar B: [34163]
    complexed with u89

Details for d1garb_

PDB Entry: 1gar (more details), 1.96 Å

PDB Description: towards structure-based drug design: crystal structure of a multisubstrate adduct complex of glycinamide ribonucleotide transformylase at 1.96 angstroms resolution
PDB Compounds: (B:) glycinamide ribonucleotide transformylase

SCOPe Domain Sequences for d1garb_:

Sequence, based on SEQRES records: (download)

>d1garb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Sequence, based on observed residues (ATOM records): (download)

>d1garb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpdeehgts
vhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhena
awldgqrlppqgya

SCOPe Domain Coordinates for d1garb_:

Click to download the PDB-style file with coordinates for d1garb_.
(The format of our PDB-style files is described here.)

Timeline for d1garb_: