Lineage for d5veuc_ (5veu C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331534Protein automated matches [190068] (8 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (50 PDB entries)
  8. 2331617Domain d5veuc_: 5veu C: [341626]
    automated match to d1w0ea_
    complexed with hem, rit

Details for d5veuc_

PDB Entry: 5veu (more details), 2.91 Å

PDB Description: human cytochrome p450 3a5 (cyp3a5)
PDB Compounds: (C:) Cytochrome P450 3A5

SCOPe Domain Sequences for d5veuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5veuc_ a.104.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
hrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyelathpd
vqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingv
fipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprncigmrf
almnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr

SCOPe Domain Coordinates for d5veuc_:

Click to download the PDB-style file with coordinates for d5veuc_.
(The format of our PDB-style files is described here.)

Timeline for d5veuc_: