Lineage for d5omxb_ (5omx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987576Protein Histone H4 [47125] (7 species)
  7. 1987577Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (57 PDB entries)
  8. 1987627Domain d5omxb_: 5omx B: [341624]
    Other proteins in same PDB: d5omxc_, d5omxd_, d5omxg_, d5omxh_
    automated match to d1tzyd_
    complexed with cl, mn

Details for d5omxb_

PDB Entry: 5omx (more details), 2.32 Å

PDB Description: x-ray structure of the h2a-n38c nucleosome core particle
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5omxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5omxb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5omxb_:

Click to download the PDB-style file with coordinates for d5omxb_.
(The format of our PDB-style files is described here.)

Timeline for d5omxb_: