SCOPe 2.06: Domain d5nvia_: 5nvi A:

Lineage for d5nvia_ (5nvi A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (30 PDB entries)
   Uniprot Q9ER97

8. Domain d5nvia_: 5nvi A: [341623]
   automated match to d1q1fa_
   complexed with ar, hem, so4

Details for d5nvia_

PDB Entry: 5nvi, 1.6 Å

PDB Description: crystal structure of murine neuroglobin under 50 bar argon pressure

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d5nvia_:

Sequence; same for both SEQRES and ATOM records:

>d5nvia_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

Timeline for d5nvia_:

• d5nvia_ is new in SCOPe 2.06-stable
  
• d5nvia_ appears in SCOPe 2.07
  
• d5nvia_ appears in the current release, SCOPe 2.08