Lineage for d5vkga_ (5vkg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939400Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2939401Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2939402Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
  8. 2939416Domain d5vkga_: 5vkg A: [341618]
    automated match to d1m4qa_
    complexed with 4n1

Details for d5vkga_

PDB Entry: 5vkg (more details)

PDB Description: solution-state nmr structural ensemble of human tsg101 uev in complex with tenatoprazole
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d5vkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vkga_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d5vkga_:

Click to download the PDB-style file with coordinates for d5vkga_.
(The format of our PDB-style files is described here.)

Timeline for d5vkga_: