Lineage for d5mjqa_ (5mjq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979033Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1979099Species Thermosynechococcus elongatus [TaxId:197221] [189582] (9 PDB entries)
  8. 1979107Domain d5mjqa_: 5mjq A: [341615]
    Other proteins in same PDB: d5mjqb_
    automated match to d1jboa_
    complexed with cyc

Details for d5mjqa_

PDB Entry: 5mjq (more details), 2.7 Å

PDB Description: single-shot pink beam serial crystallography: phycocyanin (one chip)
PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d5mjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mjqa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d5mjqa_:

Click to download the PDB-style file with coordinates for d5mjqa_.
(The format of our PDB-style files is described here.)

Timeline for d5mjqa_: