SCOPe 2.06: Domain d5mjqa_: 5mjq A:

Lineage for d5mjqa_ (5mjq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189582] (9 PDB entries)

8. Domain d5mjqa_: 5mjq A: [341615]
   Other proteins in same PDB: d5mjqb_
   automated match to d1jboa_
   complexed with cyc

Details for d5mjqa_

PDB Entry: 5mjq, 2.7 Å

PDB Description: single-shot pink beam serial crystallography: phycocyanin (one chip)

PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d5mjqa_:

Sequence; same for both SEQRES and ATOM records:

>d5mjqa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d5mjqa_:

• d5mjqa_ is new in SCOPe 2.06-stable
  
• d5mjqa_ appears in SCOPe 2.07
  
• d5mjqa_ appears in the current release, SCOPe 2.08