Lineage for d2gar__ (2gar -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26052Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 26053Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 26054Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 26055Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 26056Species Escherichia coli, k12 strain tx635, with plasmid pjs167 [53331] (8 PDB entries)
  8. 26057Domain d2gar__: 2gar - [34161]

Details for d2gar__

PDB Entry: 2gar (more details), 1.8 Å

PDB Description: a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase

SCOP Domain Sequences for d2gar__:

Sequence, based on SEQRES records: (download)

>d2gar__ c.65.1.1 (-) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Sequence, based on observed residues (ATOM records): (download)

>d2gar__ c.65.1.1 (-) Glycinamide ribonucleotide transformylase, GART {Escherichia coli, k12 strain tx635, with plasmid pjs167}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpshgtsvhfvtd
eldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgq
rlppqgya

SCOP Domain Coordinates for d2gar__:

Click to download the PDB-style file with coordinates for d2gar__.
(The format of our PDB-style files is described here.)

Timeline for d2gar__: