Lineage for d5o27a_ (5o27 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978605Protein Neuroglobin [100978] (2 species)
  7. 1978613Species Mouse (Mus musculus) [TaxId:10090] [109625] (30 PDB entries)
    Uniprot Q9ER97
  8. 1978641Domain d5o27a_: 5o27 A: [341600]
    automated match to d4nzia_
    complexed with hem, so4, xe; mutant

Details for d5o27a_

PDB Entry: 5o27 (more details), 2.31 Å

PDB Description: crystal structure of murine neuroglobin mutant v140w under 30 bar xenon pressure
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d5o27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o27a_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygawvqamsrgwdg

SCOPe Domain Coordinates for d5o27a_:

Click to download the PDB-style file with coordinates for d5o27a_.
(The format of our PDB-style files is described here.)

Timeline for d5o27a_: