SCOPe 2.08: Domain d5tvha1: 5tvh A:1-208

Lineage for d5tvha1 (5tvh A:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5tvha1: 5tvh A:1-208 [341595]
   Other proteins in same PDB: d5tvha2, d5tvhb2, d5tvhc2, d5tvhd2, d5tvhe2
   automated match to d2w8gc_
   complexed with 7ko, dms, nag

Details for d5tvha1

PDB Entry: 5tvh, 2.4 Å

PDB Description: crystal structure of achbp from aplysia californica complex with 2- aminopyrimidine at ph 8.0 spacegroup p21

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5tvha1:

Sequence; same for both SEQRES and ATOM records:

>d5tvha1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d5tvha1:

• d5tvha1 first appeared in SCOPe 2.06
  
• d5tvha1 appears in SCOPe 2.07