| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
| Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
| Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries) |
| Domain d5ugia_: 5ugi A: [341593] automated match to d1iska_ complexed with equ; mutant |
PDB Entry: 5ugi (more details), 1.8 Å
SCOPe Domain Sequences for d5ugia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ugia_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
ntpehmtavvqryvaalnagdldgivalfaddatvegpvgseprsgtaaireayanslkl
plaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekni
haga
Timeline for d5ugia_: