SCOPe 2.06: Domain d5nioa2: 5nio A:95-214

Lineage for d5nioa2 (5nio A:95-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d5nioa2: 5nio A:95-214 [341591]
   Other proteins in same PDB: d5nioa1
   automated match to d1t56a2
   protein/DNA complex; complexed with 8yh, so4

Details for d5nioa2

PDB Entry: 5nio, 1.4 Å

PDB Description: ethr complex

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nioa2:

Sequence; same for both SEQRES and ATOM records:

>d5nioa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5nioa2:

• d5nioa2 is new in SCOPe 2.06-stable
  
• d5nioa2 appears in SCOPe 2.07
  
• d5nioa2 appears in the current release, SCOPe 2.08