SCOPe 2.08: Domain d5nmdc2: 5nmd C:112-201

Lineage for d5nmdc2 (5nmd C:112-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5nmdc2: 5nmd C:112-201 [341589]
   Other proteins in same PDB: d5nmda1, d5nmdb1, d5nmdb2, d5nmdc1, d5nmdd1, d5nmdd2
   automated match to d2bnqd2
   complexed with edo, so4

Details for d5nmdc2

PDB Entry: 5nmd, 2.07 Å

PDB Description: 868 tcr specific for hla a02 presenting hiv epitope slyntvatl

PDB Compounds: (C:) Human T-cell receptor alpha chain

SCOPe Domain Sequences for d5nmdc2:

Sequence; same for both SEQRES and ATOM records:

>d5nmdc2 b.1.1.2 (C:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hiqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

Timeline for d5nmdc2:

• d5nmdc2 first appeared in SCOPe 2.06
  
• d5nmdc2 appears in SCOPe 2.07